SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009473 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009473
Domain Number 1 Region: 521-553,635-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000011
Family Anti-sigma factor antagonist SpoIIaa 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009473   Gene: ENSRNOG00000006878   Transcript: ENSRNOT00000009473
Sequence length 757
Comment pep:known chromosome:RGSC3.4:6:49305008:49346002:1 gene:ENSRNOG00000006878 transcript:ENSRNOT00000009473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEAIGNQYVVARPVYSTKAFGEEFKKTYGHHKTFLDHLKGCCSCSSQKAKKIALSLFPI
ASWLPAYKIKEWLLSDIVSGISTGLVAVLQGLAFALLVNIPPAYGLYAAFFPVITYFFLG
TSRHISVGPFPVLSMMVGVVVTRVASGSDTSPALSSSSAENDSMIEEKVMVAASVTVLSG
IIQLLLGVLQIGFVVIYLSESLISGFTTAAAIHVLVSQLKFMLQLTVPAHSDPFSIFKVL
ESVFSQIQKTNIADLVTSVIILVVVFVVKEINQRYRSKLPVPIPIELIMTVIATGISYGC
NFEQRFGVAVVGNMSLGFQPPITPSVEVFQDTIGDCFGIAIVGFAVAFSVASVYSLKYDY
PIDGNQELIALGVSNIFTGAFKGFAGSTALSRSGVQESTGGKTQVAGLLSAVIVLIVIVA
IGFLLQPLQKSVLAALALGNLKGMLMQFAEIGRLWKKDKYDCLIWIMTFIFAIVLGLGLG
LAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKNYADVYEPEGVKIFRCPSPIYFA
NIGFFKQKLIDAVGFNPLRILRKRNKALKKIRKLQKQGLIQVTPKGFICTSDGFKDSDEE
LDNNQIEELDQPINTTDLPFEIDWNADLPLNITIPKISLHSLILDFSAVSFLDISSMRGL
RTILQEFIRIKVDVYIVGTDDDFIDKLARCEFFDDEVTDSIFFLTIHDAILHIWMKKDYS
TSKFNSSQEKERKFDFTINTNGGLRNRECQVPVETKF
Download sequence
Identical sequences Q924C9
NP_446207.1.100692 NP_446207.1.4139 ENSRNOP00000009473 ENSRNOP00000009473 10116.ENSRNOP00000009473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]