SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009517 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009517
Domain Number 1 Region: 37-256
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-60
Family DBL homology domain (DH-domain) 0.0000175
Further Details:      
 
Domain Number 2 Region: 242-388
Classification Level Classification E-value
Superfamily PH domain-like 2.04e-34
Family Pleckstrin-homology domain (PH domain) 0.00064
Further Details:      
 
Domain Number 3 Region: 502-634
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.31e-32
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 405-519
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.41e-27
Family DEP domain 0.0034
Further Details:      
 
Domain Number 5 Region: 618-702
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000046
Family PDZ domain 0.036
Further Details:      
 
Domain Number 6 Region: 707-769
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000499
Family PDZ domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009517   Gene: ENSRNOG00000006952   Transcript: ENSRNOT00000009517
Sequence length 1649
Comment pep:known chromosome:RGSC3.4:3:157693897:157863943:-1 gene:ENSRNOG00000006952 transcript:ENSRNOT00000009517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPGSGSGDGGGDPGGDGAHPDARGPSSGPCAAARDSERQLRLRLCVLNEILATERDYV
GTLRFLQSAFLQRIRQNVADSVDKGLTEENVKILFSNIEDILEVHKDFLAALEYCLHPEP
QSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKVPAARAFLLNCMLLGGRKTTD
IPLEGYLLSPIQRICKYPLLLKELSKRTPGKHPDHSAVQSALQAMKTVCSNINETKRQME
KLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCKRKS
RVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTA
KNKWFVCMAKTAEEKQKWLDALIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMSKKV
NLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQF
KNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYAPVIKDRDYHLKTYKSVVPG
SKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFHADEEMEGTS
SKNKQLRNDFKLVENILAKRLLIPPQEDDYGFDLEEKNKAVVVKSVQRGSLAEMAGLQAG
RKIYSINEDLVFLRPFSEVETILNQSFCSRRPLRLLVATKAKETIKIPDHPEALSFQIRG
TAPPCVFAVGRGSEAVAAGLCAGQCILKVNGNSVANDGALEVLEHFQAFRSRREEALGLY
QWVYHSHEDAQQARASQGAPDEDPQEDDSGDSFLPLLSLGPQLSLHEDSAVVSLTLDNVH
LEHGVVYEYVSTAGAKCHVLEKIVEPRGCFRLAAKILEAFAEDDSLFVQNCGRLMAMGSA
IITMSHYEFHNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEDHPLCGLDFCPT
NCHINFMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMAYTQHCITTMAAPSW
KCAPAVDGDSQSQGLIDSIFVSASGALSQQERGLSFLLKQEDREIQDAYLQLFTKLDVAL
KEMKQYVTQINRLLSTITEPTSAAPCDPPLVEETSSSPPASEESEVDRTDHGGIKKVCFK
VSEDEQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDETGSGDELPCDIRI
PSDKQDKLHGCLEHLFNQVDSIHALLKGPVMSRAFEETRHFPMEHSWQEFKQKEECTVRG
RNLIQISIQEDPWNLPSSIRTLVDNIQRYVEDGKNQLLLALLKCTDTELQLRRDAVFCQA
LVAAVCTFSEQLLAALDYRYNNNGEYEESSRDASRKWLEQVAATGVLLHWQSLLAPATVK
EERTMLEDIWVTLSELDNVTFSFKQLDENSVANTNVFYHIEGSRQALKVVFYLDGFHFSR
LPSRLEGGASLRLHTVLFTKALENVEGPSPPGSQAAEDLQQEINAQSLEKVQQYYRRLRA
FYLERSNLPTDATTTAVKIDQLIRPINALDELYRLMKSFVHPKAGAGGSLGAGLVPVSSE
LCYRLGACQITMCGTGMQRSTLSVSLEQAAILARSHGLLPKCVMQATDIMRKQGPRVEIL
AKNLRIKDPMPQGAPRLYRLCQPPVDGDL
Download sequence
Identical sequences ENSRNOP00000009517 10116.ENSRNOP00000052008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]