SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009693 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009693
Domain Number 1 Region: 108-396
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-78
Family Protein kinases, catalytic subunit 0.0000145
Further Details:      
 
Domain Number 2 Region: 46-127
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-21
Family SH3-domain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000009693
Domain Number - Region: 415-483
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00235
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009693   Gene: ENSRNOG00000007271   Transcript: ENSRNOT00000009693
Sequence length 1077
Comment pep:known chromosome:RGSC3.4:6:105593585:105651838:-1 gene:ENSRNOG00000007271 transcript:ENSRNOT00000009693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSRSLLGCLASAAAAPPGEDATGAGAEEEEDEEEAAAELGSHATLPYWTAVFEYEAAG
EDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQPGTED
PSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWVGDEVAVKAARHDPDEDISQTIEN
VRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRVPPDILVNWAV
QIARGMNYLHDEAIVPVIHRDLKSSNILILQKVENGDLSNKTLKITDFGLAREWHRTTKM
SAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLA
LPIPSTCPEPFAKLMEDCWNPDPHSRPSFSSILDQLTTIEESGFFEMPKDSFHCLQDDWK
HEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILERELNII
IHQLCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSLISNRS
SPPASPTIIPRLRAIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWGPGTLGQK
ELTSGDEGLKSLVDGYKQWSSSAPNLGKGPRSSPALPGFTSLMEIEDEDSEGPGSGENHL
QHSPNQSYLCIPFPRGEDGDGPSSDGIHEEPTPVNSATSTPQLTPTNSLKRSGTHHRRCE
VALLGCGAVLAATGLGFDLLEAGKCQLLPPEEPEPPAREEKKRREGLFQRASRPRRSTSP
PSRKLFKKEEPMTLLGDPSASLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPVSPVEAP
PLTQCTQNPLVNVRVERFKRDPNQSLTPTHVTLTAPTQPSGHRRTPSDGALKPASVPPAL
GSRSPSSNGVSPGPGAGMLKTPSPSRDPGEFPRLPDPNVVFPPTPRRWNTQRDSTLERPK
TLEFLPRPRPSANRQRLDPWWFVSPSHARSASPANSSSTETPSNLDSCFASSSSTVEERP
GLPALLPLQAGPLPPAERTLLDLDAEGQSQDSTVPLCRAELNAHGPSPYEIQQEFWS
Download sequence
Identical sequences A0A0G2JUN9
ENSRNOP00000009693 10116.ENSRNOP00000009693 NP_001094342.1.100692 NP_001094342.1.4139 ENSRNOP00000009693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]