SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009802 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009802
Domain Number 1 Region: 538-668
Classification Level Classification E-value
Superfamily PH domain-like 9.86e-38
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-19
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 
Domain Number 3 Region: 201-300
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-17
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009802   Gene: ENSRNOG00000007014   Transcript: ENSRNOT00000009802
Sequence length 1032
Comment pep:known chromosome:RGSC3.4:X:58198067:58440335:1 gene:ENSRNOG00000007014 transcript:ENSRNOT00000009802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALIMEPVSKWSPSQVVDWMKGLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRI
GHQELILEAVDLLCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKL
PNDFLTSVVDLIGAAKSLLAWLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYET
ENKILHVCKTLSGVCDHIISLSSDPLVSQSAHLEVIQLANIKPSEGLGMYIKSTYDGLHV
ITGTTENSPADRCKKIHAGDEVIQVNHQTVVGWQLKNLVNALREDPSGVILTLKKRPQSM
LTSAPALLKNMRWKPLALQPLIPRSPTSSVATPSSTISTPTKRDSSALQDLYIPPPPAEP
YIPRDEKGNLPCEDLRGHMVGKPVHKGSESPNSFLDQEYRKRFNIVEEDTVLYCYEYEKG
RSSSQGRRESTPTYGKLRPISMPVEYNWVGDYEDPNKMKRDSRRENSLLRYMSNEKIAQE
EYMFQRNSKKDTGKKSKKKGDKSTSPTHYSLLPSLQMDALRQDIMGTPVPETTLYHTFQQ
SSLQHKSKKKNKGAIAGKSKRRISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKD
ASLYWYINEEDEKAEGFISLPEFKIDRASECRKKYAFKACHPKIKSFYFAAEHLDDMNRW
LNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCAS
PYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSG
LHYLQTLPLEDSVFSDSAAISPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGG
KPRSFTLPRDSGFNHCCLNAPVSACDPQDDIQPPEVEEEEEEEEEEAAGENIGEKNENRE
EKLGDSLQDLYRALEEASLSPLGEHRISTKIEYKLSFIKRCNDPVMNEKLHRLRILKSTL
KAREGEVAIIDKVLDNPDLTSKEFQQWKQMYLDLFLDICQNTTSNDPLSISSEVDVITSS
LTHTHSYIETHV
Download sequence
Identical sequences Q9Z1T4
NP_001106837.1.100692 NP_001106837.1.4139 10116.ENSRNOP00000009802 ENSRNOP00000009802 ENSRNOP00000009802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]