SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009979 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009979
Domain Number 1 Region: 90-190
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-19
Family PDZ domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009979   Gene: ENSRNOG00000007346   Transcript: ENSRNOT00000009979
Sequence length 394
Comment pep:known chromosome:RGSC3.4:7:139970173:139977939:1 gene:ENSRNOG00000007346 transcript:ENSRNOT00000009979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRRLRKLQQKEEATAAPDLAGRAPDSEAARAAPTPSGPPAAAAPPGAPGDELYAALED
YHPAELYRALAVSGGTLPRRKGSGFRWKNFTQSPEQQRKVLTLEKGDNQTFGFEIQTYGL
HHREEQRVEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNV
LRLETLYGTSIRKAELEARLQYLKQTLYEKWGEYRSLMVQEQRLVHGLVVKDPSIYDTLE
SVRSCLYGAGLLPGSLPFGPLLAAPGGARGGSRRAKGDTDDAVYHTCFFGGAEPQALPPP
PPPARAPGPGSAETPASVLCPAPRATLSRSASVRCAGPGGGGGGGAPGALWTEAREQALC
GAGLRKTKYRSFRRRLLKFIPGLNRSLEEEESQL
Download sequence
Identical sequences Q8R4T5
ENSRNOP00000009979 ENSRNOP00000009979 NP_620249.1.100692 NP_620249.1.4139 10116.ENSRNOP00000009979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]