SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010065 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010065
Domain Number 1 Region: 514-600
Classification Level Classification E-value
Superfamily PDZ domain-like 9.33e-22
Family PDZ domain 0.0035
Further Details:      
 
Domain Number 2 Region: 29-107
Classification Level Classification E-value
Superfamily HR1 repeat 1.07e-19
Family HR1 repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010065   Gene: ENSRNOG00000007597   Transcript: ENSRNOT00000010065
Sequence length 668
Comment pep:known chromosome:RGSC3.4:7:113665498:113675077:1 gene:ENSRNOG00000007597 transcript:ENSRNOT00000010065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASEWAAMILEERPDGQGTGEDSPRQQNDGSIRKGHDSFVQNQPGQLHSHRARLHQQISK
ELRMRTGAENLYRATSNTWVRETVALELSYVNSNLQLLKEELAELSCNADVDQPEGESVT
IPMIPLGLKETKELDWATPLKELISEHFGEDGASYETEIQELEDLRQATRTPSRDEVGLD
LLAAYYSQLCFLDARFFSPARSPGLLFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQ
IGARQDCSCTEGTSQAAEAFQRAAGAFRLLRENFSHAPSPDMSAASLSMLEQLMVAQAQE
CIFRGLLLRASATPDICPDQLQLAQEATQVATEYGLVHRAMAQPPVRDYLPASWTNLARV
KAEHFCALAHYHAAMALCESTSAKGELSRQEDIFQPSATCEPQGPTLPQHPEERRKLAKA
HLKRAILGQEEALRLHTLCRVPRKVDLLQVVVTQALRRSLTKYSELEREDDFFEAMEAPD
IQPKTHQAPEVSIPSLSQVKVTDFFHRLGPLSVFSTKNRWQLVGPVHMTRGEGGFGFTLR
GDSPVLIAAVVPGGQAESAGLKEGDYIVSVNGQPCKWWKHVEVVTQLRSMGEEGVSLQVV
SLLPGPEPRGTGPRRPALLWNQRECGFETPTPAHTRPWPILGWSRKNKQSKSGSHPDPCT
NRNCITCP
Download sequence
Identical sequences 10116.ENSRNOP00000010065 ENSRNOP00000010065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]