SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010090 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010090
Domain Number 1 Region: 254-299
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000399
Family HtrA-like serine proteases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010090   Gene: ENSRNOG00000007644   Transcript: ENSRNOT00000010089
Sequence length 519
Comment pep:known chromosome:RGSC3.4:X:58737260:58761049:1 gene:ENSRNOG00000007644 transcript:ENSRNOT00000010089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPVSLVVVVVGGWTAVYLADLVLKSSVYFKHSYEDWLENNGLSISPFHIRWQTSIFNRA
FYSWGRRKARMLYQWFNFGMVFGVIAMFSSFFLLGKTLMQTLAQMMADSPSPYSSSSSSS
SSSSSSSSSSSSSSSSLHNDQVLQVVVPGINLPVNQLTYFFAAVLISGVVHEIGHGIAAI
REQVRFNGFGIFLFIIYPGAFVDLFTTHLQLISPVQQLRIFCAGIWHNFVLALLGILALV
LLPVILLPFYYTGVGVLITEVAEDSPAIGPRGLFVGDLVTHLQDCPVTNVQDWNECLDTI
AYEPQIGYCISASTLQQLSFPVRAYKRLDGSTECCNNHSLTDVCFSYRNNFNKRLHTCLP
ARKAVEATQVCRSNKDCKSSSSSSFCIVPSLETHTRLIKVKHPPQIDMLYVGHPLHLHYT
VSITSFIPRFNFLSIDLPVIVETFVKYLISLSGALAIVNAVPCFALDGQWILNSFLDATL
TSVIGDNDVKDLIGFFILLGGSVLLAANVTLGLWMVTAR
Download sequence
Identical sequences D3ZDS6
10116.ENSRNOP00000031616 ENSRNOP00000010090 ENSRNOP00000031616 NP_001030179.1.100692 NP_001030179.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]