SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010252 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010252
Domain Number 1 Region: 187-528
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.44e-89
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000717
Further Details:      
 
Domain Number 2 Region: 528-660
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.75e-31
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0015
Further Details:      
 
Domain Number 3 Region: 51-180
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 6.93e-25
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010252   Gene: ENSRNOG00000007739   Transcript: ENSRNOT00000010252
Sequence length 660
Comment pep:known chromosome:RGSC3.4:10:20721171:20745484:-1 gene:ENSRNOG00000007739 transcript:ENSRNOT00000010252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGLVAQCSARLLQQEKEIKSLTAEIDRLKNCSYLEASPSLEQLREENLKLKYRLNILRR
SLQAERKRPTKNMININSRLQELFGCAIKAAYPDLENPPLVVTPSQQPKFGDYQCNSAMG
ISQMLKAKEQKVSPREIAENITKHLPNNEYIDRVEIAGPGFINVHLRKDFVSEQLTNLLV
NGVQLPVLGENEKVIVDFSSPNIAKEMHVGHLRSTIIGESMSRLFEFAGYNVLRLNHVGD
WGTQFGMLIAHLQDKFPDYLTVSPPIGDLQAFYKESKKRFDTEEEFKKRAYECVVLLQSK
NPDIMKAWNLICDVSREEFNKIYDALDITLIERGESFYQDRMKDIVKEFEDKGFVQVDDG
RKIVFVPGCSVPLTIVKSDGGYTYDTSDLAAIKQRLFEEKANKIIYVVDNGQATHFQTVF
AAAQMIGWYDPKVTRVAHVGFGVVLGEDKKKFKTRSGETVRLMDLLEEGLRRSMDKLKEK
ERDKVLTEEELKAAQTSVAYGCIKYADLSHNRLNDYVFSFDKMLDDRGNTAAYLLYAFTR
IRSIARLANIDEEMLQRAARETKIILDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDY
IYELATTFTEFYDSCYCVEKDRQTGKVLKVNMWRMLLCEAVAAVMAKGFDILGIKPVQRM
Download sequence
Identical sequences P40329
NP_001099247.2.100692 NP_001099247.2.4139 ENSRNOP00000010252 ENSRNOP00000010252 10116.ENSRNOP00000010252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]