SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010579 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010579
Domain Number 1 Region: 10-147
Classification Level Classification E-value
Superfamily MAPEG domain-like 1.17e-42
Family MAPEG domain 0.00000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010579   Gene: ENSRNOG00000007743   Transcript: ENSRNOT00000010579
Sequence length 155
Comment pep:known chromosome:RGSC3.4:4:175248654:175263879:1 gene:ENSRNOG00000007743 transcript:ENSRNOT00000010579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLKQLMDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDCAGFGKGENAK
KFLRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIA
YLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL
Download sequence
Identical sequences B6DYQ4 P08011
ENSRNOP00000010579 5i9k_A 5ia9_A ENSRNOP00000010579 NP_599176.1.100692 NP_599176.1.4139 10116.ENSRNOP00000010579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]