SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010626 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010626
Domain Number 1 Region: 480-824
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.96e-115
Family Rap/Ran-GAP 0.000000534
Further Details:      
 
Domain Number 2 Region: 953-1027
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000013
Family PDZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000010626
Domain Number - Region: 860-938
Classification Level Classification E-value
Superfamily PH domain-like 0.0541
Family Third domain of FERM 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010626   Gene: ENSRNOG00000007646   Transcript: ENSRNOT00000010626
Sequence length 1751
Comment pep:known chromosome:RGSC3.4:6:106173292:106283050:1 gene:ENSRNOG00000007646 transcript:ENSRNOT00000010626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLKRSQTERPVTADRASVVSTDGTPKVHTDDFYMRRFRSQNGSLGSSVMAAVGPPRSE
GPHHITSTPGVPKMGVRARIADWPPRKENVKESSRSSQEIETSSCLESLSSKGSPVSQGS
SVSLNSNDSAMLKSIQNTLKNKTGPAESMDSRFLMPEAYPSSPRKALRRIRQRSNSDITI
SELDVDSFDECISPTYKSGPSLHREYGSTSSIDKQGTSGESFFGLLKGYKDDRADRGPTP
TKLSDFLITGGGKGSGFSLDVIDGPISQRENLRLFKEREKPLKRRSKSETGDSSIFRKLR
NAKGEELGKSSDLEDNRSEDSVRPWTCPKCFAHYDVQSILFDLNEAIMNRHNVIKRRNTT
TGASAAAVASLVSGPLSHSASFSSPMGSTEDLNSKGSLGMDQGDDKSNELVMSCPYFRNE
IGGEGERKISLSKSNSGSFSGCESTSFESALSSHCTNAGVAVLEVPKESLMLHLDRVRRY
TVEHVDLGAYYYRKCFYQKEHWNYFGADENLGPVAVSIRREKPEDMKENGSPYNYRIIFR
TSELMTLRGSVLEDAIPSTAKHSTARGLPLKEVLEHVIPELNVQCLRLAFNTPKVTEQLM
KLDEQGLNYQQKVGIMYCKAGQSTEEEMYNNESAGPAFEEFLQLLGERVRLKGFEKYRAQ
LDTKTDSTGTHSLYTTYKDYEIMFHVSTMLPYTPNNKQQLLRKRHIGNDIVTIVFQEPGA
QPFSPKNIRSHFQHVFVIVRAHNPCTESVCYSVAVTRSRDVPSFGPPIPKGVTFPKSNVF
RDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAEKNVTNTPIDPSGKFPFISLASK
KKEKSKPYPGAELSSMGAIVWAVRAKDYNKAMEFDCLLGISNEFIVLIEQETKSVVFNCS
CRDVIGWTSSDSSLKIFYERGECISVESFMSSEDIKEIVKRLQFVSKGCESVEMTLRRNG
LGQLGFHVNYEGIVADVEPYGYAWQAGLRQGSRLVEICKVAVATLSHEQMIDLLRTSVTV
KVVIIPPHDDCTPRRSCSETYRMPVMEYKMNEGVSYEYKFPFRSNNKWQRNAGKGAHSPQ
VPSQLQSPMTSRLNAGKGDGKMPPPERAANIPRSISSDGRPLERRLSPGSDIYVTVSSMA
LARSQCRNSPSNLSSSSETGSGGGTYRQKSMPEGFGVSRRSPASIDRQNTQSDIGGSGKS
TPSWQRSEDSLADQMEPTCHLPAVSKVLPAFRESPSGRLMRQDPVVHLSPNKQGHSDSHY
SSHSSSNTLSSNASSAHSDEKWYDGDRTESDLNSYNYLQGTSADSGIDTASYGLSHGSTA
SLGASTSSPRSGPGKEKVAPLWHSSSEVLSLADRTLETEGHGMDRKTESSLSLDIHSKSQ
GGSSPLTRENSTFSINDATSHTSTMSSRHSASPVVFSSARSSPKEELHPTTSSQLAPSFS
SSSSSSSGPRTFYPRQGATSKYLIGWKKPEGTINSVGFMDTRKRHQSDGNEIAHTRLRAS
TRDLRASPKPTSKSTIEEDLKKLIDLESPTPESQKNFKFHGLSSPQSPFPSTPTSRRALH
RTLSDESIYSSQREHFFTSRASLLDQALPNDVLFSSTYPSLPKSLPLRRPSYTLGMKSLH
GEFSASDSSLTDIQETRRQPIPDPGLMPLPDTASDLDWSNLVDAAKAYEVQRASFFAASD
ENHRPLSAASNSDQLEEQALVQMKSYSSKDSSPTLASKVDQLEGMLKMLREDLKKVNVLR
KGRQGPPAGRG
Download sequence
Identical sequences ENSRNOP00000010626 10116.ENSRNOP00000010626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]