SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010682 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010682
Domain Number 1 Region: 103-234
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-45
Family Regulator of G-protein signaling, RGS 0.00000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010682   Gene: ENSRNOG00000008100   Transcript: ENSRNOT00000010682
Sequence length 242
Comment pep:known chromosome:RGSC3.4:5:14737677:14816907:1 gene:ENSRNOG00000008100 transcript:ENSRNOT00000010682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTANGGPRAGASPSASPEDPNLPVESEQTEMRMRQMCSGSETQGSVPSQQQGVGGRGSN
ACCFCWCCCCSCSCLTVRNQEDQRPQRAAHELRTDIPACEESPMPTLEEVCAWAQSFDNL
MVTPAGRNAFREFLRTEFSEENMLFWMACEELKREANKSTIEEKARIIYEDYISILSPKE
VSLDSRVREVINRNMVDPSQHIFDDAQLQIYTLMHRDSYPRFMNSTVYKDLLKSLAEKAV
EA
Download sequence
Identical sequences G3V716
ENSRNOP00000010682 ENSRNOP00000010682 10116.ENSRNOP00000010682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]