SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010810 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010810
Domain Number 1 Region: 121-592
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 2.49e-148
Family Class I alpha-1;2-mannosidase, catalytic domain 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010810   Gene: ENSRNOG00000007944   Transcript: ENSRNOT00000010810
Sequence length 650
Comment pep:known chromosome:RGSC3.4:4:144350033:144379198:1 gene:ENSRNOG00000007944 transcript:ENSRNOT00000010810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWRALVLGLVLLRLGLHAVLWLVFGLGPSMGFYQRFPLSFGFQRLRDPDGSGPVGPPGG
PSWLHRPRRGTEGRLETPPGPGPGPGVCGPAHWGYALGGGGCGLDEYERRYSGAFPPQLR
AQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDLGDPSNLNINDVLGNYSLTLV
DALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQP
FGDMTIEDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGAG
SLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLGA
GLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQSYLRRGREACNEGEGDPPLYVNVNMFS
GQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQLQAPDVLF
YPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKEDRME
SFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDKRLRELPWKEFFSEDGERDQ
EEKFVHRPKSQELRVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI
Download sequence
Identical sequences D3ZJE0
ENSRNOP00000010810 NP_001292208.1.100692 NP_001292208.1.4139 ENSRNOP00000010810 10116.ENSRNOP00000010810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]