SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010852 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010852
Domain Number 1 Region: 149-351
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.84e-53
Family Prokaryotic proteases 0.000000597
Further Details:      
 
Domain Number 2 Region: 361-456
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-18
Family HtrA-like serine proteases 0.0018
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000008
Family Growth factor receptor domain 0.0031
Further Details:      
 
Domain Number 4 Region: 86-134
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000309
Family Ovomucoid domain III-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010852   Gene: ENSRNOG00000008182   Transcript: ENSRNOT00000010852
Sequence length 459
Comment pep:known chromosome:RGSC3.4:14:80702182:80730028:1 gene:ENSRNOG00000008182 transcript:ENSRNOT00000010852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQARALLPATLATLATLAVSVLAREPPAAPCPARCDVSRCPSPRCPGGYVPDLCNCCLVC
AASEGEPCGRPLDSPCGDSLECVRGVCRCRWTHTVCGTDGHTYADVCALQAASRRALQIS
GTPVRQLQKGACPSGLHQLTSPRYKFNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSS
GSGFIMSEAGLIVTNAHVVSSSNTASGRQQLKVQLQNGDAYEATIQDIDKKSDIATILIH
PNKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGKELGLRDSDMDYI
QTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITRFLSEFQDKHVKDWKK
RFIGIRMRTITPSLVEELKTANPDFPAVSSGIYVQEVVPNSPSQRGGIQDGDIIVKVNGR
PLVDSSELQEAVLNESSLLLEVRRGNDDLLFSIMPEVVM
Download sequence
Identical sequences D3ZA76
ENSRNOP00000010852 10116.ENSRNOP00000010852 NP_001257956.1.100692 NP_001257956.1.4139 ENSRNOP00000010852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]