SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010872 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010872
Domain Number 1 Region: 111-217
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 6.8e-27
Family Elongation factor TFIIS domain 2 0.0065
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 7.72e-21
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00016
Further Details:      
 
Domain Number 3 Region: 240-278
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000295
Family Transcriptional factor domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010872   Gene: ENSRNOG00000008114   Transcript: ENSRNOT00000010872
Sequence length 280
Comment pep:known chromosome:RGSC3.4:8:8925695:8926597:1 gene:ENSRNOG00000008114 transcript:ENSRNOT00000010872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGAIEDEVVHIAKKMDKMVQKKNVAGISDMPKELKNICMPLELLQSTRFGKSVNAILKQS
TDEEVISLAKSLIKSWKILLDEPSTGKDPEAREESCSSSNISTSKDETSTRDTYASSVPR
APSTSDSVRLKCRETLAAALRTGDDYVAIGADEEELGSQIEEAIYKEIRNTDKKYKSPER
TRISNIKDAKNPNNVLCGKISPDLFARMRAEEMASDELKKDKEKPDQRSHQGVSETKTSG
TQTDWFCGKCKKNCTYTQVQTRSADEQMTTFACANRWKFC
Download sequence
Identical sequences 10116.ENSRNOP00000010872 ENSRNOP00000010872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]