SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010887 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010887
Domain Number 1 Region: 424-575
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-25
Family SPRY domain 0.011
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 7.73e-17
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 174-237
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000183
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000010887
Domain Number - Region: 130-163
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0392
Family AN1-like Zinc finger 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010887   Gene: ENSRNOG00000008215   Transcript: ENSRNOT00000010887
Sequence length 642
Comment pep:known chromosome:RGSC3.4:10:106211265:106215736:-1 gene:ENSRNOG00000008215 transcript:ENSRNOT00000010887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRSAGGTGGSGGPARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGSSPGPMSAPAPGSARGATPEPSAPSAPPPAPEPSAPCA
PEPWPAGEEPVRCDACPEGAALPAALSCLSCLASFCSAHLAPHERSPALRGHRLVPPLRR
LEESLCPRHLRPLERYCRVERVCLCEACATQEHRGHELVPLEQERALQEVEQSKVLSAVE
DRMDELGAGIAQSRRTVALIKSAAVAERERVSQMFAEATASLQSFQTEVLGFIEEGEAAM
LGRSQGDLRRQEEQRSRLSRARHNLSQVPEADSVSFLQELLALRLALEEGCGPGPGPPRE
LSFTKSSQAVRAVRDILVSACASQWEQLRGLGSGEDELQKLGSEADVESQDPDSTNLLES
EAPRDYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTRFTHCEQVLGEGA
LDRGTYYWEVEIIEGWVSVGVMAEGFSPQEPYDRGRLGRNAHSCCLQWNGRGYSVWFCGL
EAPLPHAFSPTVGVCLEYADHALAFYAVREGKLSLLRRLKASRPRRSGALASPTDPFQSR
LDSHFSGLFNYRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences D3ZA22
ENSRNOP00000010887 10116.ENSRNOP00000010887 NP_001103055.1.100692 NP_001103055.1.4139 ENSRNOP00000010887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]