SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011023 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011023
Domain Number 1 Region: 9-153
Classification Level Classification E-value
Superfamily UBC-like 1.4e-52
Family UBC-related 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011023   Gene: ENSRNOG00000008348   Transcript: ENSRNOT00000011023
Sequence length 235
Comment pep:known chromosome:RGSC3.4:7:11534544:11539941:-1 gene:ENSRNOG00000008348 transcript:ENSRNOT00000011023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAXPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKA
RLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDG
VKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEADSCFGDEEDDSGTEES
Download sequence
Identical sequences ENSRNOP00000011023 10116.ENSRNOP00000011023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]