SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011082 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011082
Domain Number 1 Region: 43-502
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.67e-184
Family GABA-aminotransferase-like 0.0000000000000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011082   Gene: ENSRNOG00000008106   Transcript: ENSRNOT00000011082
Sequence length 504
Comment pep:known chromosome:RGSC3.4:7:67494470:67499540:-1 gene:ENSRNOG00000008106 transcript:ENSRNOT00000011082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPFSLLRTTRPLQRCGQLVCMAARAQHSEVAQKQAGEAAGGWTGQESLSDSDPEIWELL
QREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQ
RRALEAFDLDPAQWGVNVQPYSGSPANLAAYTALLQPHDRIMGLDLPDGGHLTHGYMSDV
KRISATSIFFESMPYKLNPQTGLIDYDQLALTARLFRPRLIIAGTSAYARLIDYARMREV
CDEVKAHLLADMAHISGLVAAKVIPSPFKYADIVTTTTHKTLRGARSGLIFYRKGVRTVD
PKTGQEIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLRNAQA
MADALLKRGYSLVSGGTDTHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAIT
PGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKRKTAKLQDFKSFLLKDPETSQ
RLANLRQQVEQFARGFPMPGFDER
Download sequence
Identical sequences Q5U3Z7
ENSRNOP00000011082 NP_001008323.1.100692 NP_001008323.1.4139 10116.ENSRNOP00000011082 ENSRNOP00000011082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]