SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011416 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011416
Domain Number 1 Region: 195-259
Classification Level Classification E-value
Superfamily Homeodomain-like 3.08e-24
Family Homeodomain 0.0000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011416   Gene: ENSRNOG00000008506   Transcript: ENSRNOT00000011416
Sequence length 297
Comment pep:known chromosome:RGSC3.4:10:85098903:85100232:1 gene:ENSRNOG00000008506 transcript:ENSRNOT00000011416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYNRMNSFLEYPLCNRGPSAYSAPTSFPPSSAPAVDSYAGESRYGGGLPSSALQQNSGY
PVQQPPSSLGVSFPSSAPSGYAPAACNPSYGPSQYYSMGQSEGDGGYFHPSSYGAQLGGL
PDSYGAGGVGSGPYPPPQPPYGTEQTSNFASAYDLLSEDKESSCSSEPSSLTARTFDWMK
VKRNPPKTAKVSELGLGTPGGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNE
TQVKIWFQNRRMKQKKREREGGRVPAGPPGCPKEAAGEASDQSACTSPEASPSSITS
Download sequence
Identical sequences G3V737
10116.ENSRNOP00000011416 ENSRNOP00000011416 ENSRNOP00000011416 XP_001081344.1.4139 XP_220896.4.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]