SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011448 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011448
Domain Number 1 Region: 1122-1317
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.000026
Further Details:      
 
Domain Number 2 Region: 912-1035
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-31
Family Pleckstrin-homology domain (PH domain) 0.000000523
Further Details:      
 
Domain Number 3 Region: 15-140
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-20
Family PDZ domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000011448
Domain Number - Region: 126-171
Classification Level Classification E-value
Superfamily Triosephosphate isomerase (TIM) 0.054
Family Triosephosphate isomerase (TIM) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011448   Gene: ENSRNOG00000008659   Transcript: ENSRNOT00000011448
Sequence length 1925
Comment pep:known chromosome:RGSC3.4:17:94818348:94889313:-1 gene:ENSRNOG00000008659 transcript:ENSRNOT00000011448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSKNKDGKEQGEPVSPSEDESFSWPGPKTVMLKRTSQGFGFTLRHFIVYPPESAIQFSYK
DEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIGKTYSQVI
ALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQDAYLKGNGAYSGNARDIPEPPP
VCYPWLPATPSATAQPVEVSPPDSLLNKQQTSTPVLTQPGRAYRMEIQVPPSPTDVAKSN
TAVCVCSESVRTVIVPSEKVVDLLANRNSPSGPAHRTEEVRYGVSDQASAKAAARTTPPP
SAPTARLSHQTIGSRSLEPSGILLKSGNYSGHSEGISSSRSQAVDSPPVSVNHYSANSHQ
HIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQSAADYNQVVPARTALQVRRRST
SHDRVPQSIQIRQRSVSQERLEDSVLMKYCPRSASQGALTSPPVSFSNHRTRSWDYIEGQ
SEATATVNSESQTPDSNGERKQTYKWSGFTEQDDRRGIHERPRQQEMHKPFRGSNLTVAP
VVNSDNRRLGGRGVGPVSQFKKIPPDLRPPHSNRNFPTTSGMSLPRGIAQDRSPLVKVRS
NSLKALPPPVPKPSFSQHSLASTKDQRPVNHLHQHGLLSQQTRGRPESTFPHLELQTDVS
PSLPGTSAKTSPQLSENLGTSDLDLHASPRNGDVDSQEADVQPSDVPDNKESVILREKPQ
PGRQTPQPLRHQSYILAVNDQETGSDPTCWLPNDARREVHIKRMEERKASCTSPPGDSLA
SIPFIDEPTSPSIDHEVAHIPASAVISASTSQVPSIATVPPSLTTSAPLIRRQLSHDQES
VGPPSLDGQHTSKTERSKSYDEGLDDYREDAKLSFKHVSSLKGIKIADSQKSSEDSGSRK
DSSSEVFSDAAKEGWLQFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLYKDRREQTTP
SEEEQPISVNACLIDISYSETKRRNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLN
EEDTGVTNRDLISRRIKEYNSLLSKTEQLPKTPRQSLSIRQTLLGAKSEPKTQSPHSPKE
ESERKLLSKDDTSPPKDKGTWRRGIPSIVRKTFEKKPAATGTFGVRLDDCPPAHTNRYIP
LIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMADIDIQDDKWRDLNVISSL
LKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLRTLKRLIHDLPEHHFETLKFLSAHLK
TVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQHHDWFFTEE
GAEEPLTAVQEENTVDSQPVPNIDHLLTNIGRTGVLPGDVSDSATSDSTKSKGSWGSGKD
QYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDSVFFKKENMEPSHSEIKEESKRES
ETPGRKQRVVVAKDSNTKKDTGTTKEEKKMPSDEPSPPHSSKRNRSPTLSCRLAMLKESP
RSLLTQKPHCEETGSDSGTLSSQASLARSSTKKSTSPETRHTEFLSNAGTITSDYSTTSS
TTYLTSLDSSRLSPEVQSVAESKGDEADDERSELVSEGRPVETDSESEFPVFPSALTSGQ
FRGKLQEVARSSRRNSEGSEASCTEGSLTPSLDSRRQQFSSHRLIECDTLSRKKSARFKS
DSGSPGDTRTEKETPALAKMFDVMKKGKSTGSLLTPSRSESEKQEATWKTKIADRLKLRP
RAPADDMFGVGNQKPTAETAKRKNIKRRHTLGGHRDATEISVLSFWKAQEQSADKESELS
AVNRLKPKCSAQDLSISDWLARERIRSSASDLSRSEGCEPQAESPSVLGTPTSTHTPPPS
QQPEARAAASTSASTSQPPLSTPPQSPDQINGDSFQNTSQNASSAANAHPHKLSESPNTK
TESPP
Download sequence
Identical sequences 10116.ENSRNOP00000060787 ENSRNOP00000011448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]