SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011582 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011582
Domain Number 1 Region: 258-356
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-20
Family PDZ domain 0.00059
Further Details:      
 
Domain Number 2 Region: 392-476
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-19
Family PDZ domain 0.044
Further Details:      
 
Domain Number 3 Region: 24-129
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-19
Family PDZ domain 0.0046
Further Details:      
 
Domain Number 4 Region: 153-234
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-17
Family PDZ domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011582   Gene: ENSRNOG00000008526   Transcript: ENSRNOT00000011582
Sequence length 498
Comment pep:known chromosome:RGSC3.4:8:47225269:47229670:-1 gene:ENSRNOG00000008526 transcript:ENSRNOT00000011582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAADLRDTALLTLKFKFNPRLGIDNPVLSLAEDQDQSDPWNLHRPRFCLLSKEEEKSF
GFHLQQQLGKADHVVCRVDPGSSAQRQGLREGDRILAVNNNIVEHEDYAVVVRYIRASGP
RVLLTVLAQHVYDVTRAQQGNEAFPCPTLASGVRPRLCHVVKDEGGFGFSVTHGARGPFW
LVLSAGGAAERAGVPPGARLLEVNGICVEKFTYNQLNRKLCQSGDRVTLLVAGPEVEEQC
HQLGMPLAAPLAEGWALPAKPRCLNIEKGPQGFGFLLREEKGPDGRLGQFLWEVDPGLPA
DKAGMKAGDRLVAVAGESMDGLGHEETVSRIRAQGSCVSLVVVDPEADRFFSMVRLSPLL
FLENTEIAAAPLAETKDLPVEDTVEPSGLAGSRQCFLYPGPGGGYGFRLRCVASGPCLFI
SQVTPGGSAARAGLQMGDAILEVNGCPVGGDSDLDTLQQLAEAEPPLRLKLAPRNSQGSE
AWISLESGEDWPLASELL
Download sequence
Identical sequences D4A7C5
NP_001178925.1.100692 NP_001178925.1.4139 10116.ENSRNOP00000011582 ENSRNOP00000011582 ENSRNOP00000011582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]