SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011653 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011653
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily UBC-like 4.7e-52
Family UBC-related 0.000000533
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011653   Gene: ENSRNOG00000008794   Transcript: ENSRNOT00000011653
Sequence length 125
Comment pep:known chromosome:RGSC3.4:15:9017440:9071689:1 gene:ENSRNOG00000008794 transcript:ENSRNOT00000011653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQG
VICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWT
KRYAT
Download sequence
Identical sequences 10116.ENSRNOP00000011653 ENSPCAP00000011205 XP_001518672.1.37387 XP_002188760.1.42559 ENSPCAP00000011205 ENSRNOP00000011653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]