SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011663 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011663
Domain Number 1 Region: 9-84
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-20
Family PDZ domain 0.0000458
Further Details:      
 
Domain Number 2 Region: 309-338
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000087
Family LIM domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011663   Gene: ENSRNOG00000008543   Transcript: ENSRNOT00000011663
Sequence length 349
Comment pep:known chromosome:RGSC3.4:15:50564110:50575871:-1 gene:ENSRNOG00000008543 transcript:ENSRNOT00000011663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTVNVVGPAPWGFRISGGRDFHTPIIVTKVTERGKAEAADLRPGDIIVAINGESAESM
LHAEAQSKIRQSASPLRLQLDRSQTASPGQINGEGSLDMLATRFQGSLRTHHNSQSSQRS
ACFSPASLSPRPDSPFSTPPPTSPIALSGENVIGCSFQSLTHSPGLAATHHLTYPGQPTS
QQAGHSSPSDSTVRVLLHSPGRPSSPRLSSLDLEEDSEVFKMLQENRQGRAAPRQSSSFR
LLQEALEAEERGGTPAFVPSSLSPKASLPTSRALATPPKLHTCEKCSVNISNQAVRIQEG
RYRHPGCYTCADCGLNLKMRGHFWVGNELYCEKHARQRYSMPGTLSSQA
Download sequence
Identical sequences Q6AYD6
NP_001007623.1.100692 NP_001007623.1.4139 XP_006252318.1.100692 XP_006252319.1.100692 XP_006252320.1.100692 XP_006252321.1.100692 XP_008769045.1.100692 ENSRNOP00000011663 ENSRNOP00000011663 10116.ENSRNOP00000011663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]