SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011687 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011687
Domain Number 1 Region: 121-456
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.8e-97
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000324
Further Details:      
 
Domain Number 2 Region: 458-578
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.47e-30
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00026
Further Details:      
 
Domain Number 3 Region: 4-113
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.00000000000017
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011687   Gene: ENSRNOG00000008643   Transcript: ENSRNOT00000011688
Sequence length 578
Comment pep:known chromosome:RGSC3.4:5:51226723:51268904:1 gene:ENSRNOG00000008643 transcript:ENSRNOT00000011688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACGFRRSIACQLSRVLALPPESLIKSISAVPVSKKEEVADFQLSVDSLLENNSHKSQLD
TQDQAQRLAEKLKCDTVVTAISAGPRTLNFKINRALLTKAVLQQVTEDGSKYGLKSELFS
DLPQKRIVVEFSSPNIAKKFHVGHLRSTIIGNFIANLKEALGHQVTRINYIGDWGMQFGL
LGTGFQLFGYEEKLQANPLQHLFDVYVQVNKEATDDKNVTKLAHEFFHRLELGDTQALAL
WQRFRDLSIEEYTQIYKRLGIYFDEYSGESFYREKSQDVLKLLDSKGLLQKTAKGNVVVD
VSETGDLSSVCTVMRSDGTSLYATRDLAAAIHRKDKYNFDTMIYVADKGQKRHFQQVFQM
LKIMGHEWAERCQHVPFGIVKGMKTRRGEVTFLEDVLNEVQSRMLQNMASIKTTKKMENP
RETAEKVGLAALIIQDFRGLLLSDYQFSWDRVFQSRGDTGVFLQYTHARLCSLEETFGCG
YLNDFNVACLQEPQSVSILQHLLRFDEVLYTASQDLQPKHIVSYLLTLSHLAAVAHKTLQ
VKDSPPEVAGARLHLFKAVRSVLANGMKLLGITPVCKM
Download sequence
Identical sequences B0BNA3
NP_001100113.1.100692 NP_001100113.1.4139 10116.ENSRNOP00000011687 ENSRNOP00000011687 ENSRNOP00000011687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]