SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011956 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011956
Domain Number 1 Region: 6-86
Classification Level Classification E-value
Superfamily PDZ domain-like 2e-18
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011956   Gene: ENSRNOG00000008949   Transcript: ENSRNOT00000011956
Sequence length 978
Comment pep:known chromosome:RGSC3.4:15:3857420:3865349:1 gene:ENSRNOG00000008949 transcript:ENSRNOT00000011956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAEEEVQVTLAGGAPWGFRLQGGAEQRKPLQVSKIRRRSQAGRSGLRERDQLLSINGVS
CTDFSHASAMTLIDASGHQLVLTVRRVAEEGSVRSPSPGELQMLSPLSPLSPEPPGAPVT
QAPQPGSLRSPPDSEAYYGETDSDVDGPATHEKPRRTRRRGPPRPSLPGAPPDEVYLSDS
PAEPAPVKTGSPSQGDSRVSSPSWEEGSALQPPPAEALLLPHGPLRPGPHLIPMVGPVPH
PVAEDLTTTYTQKAKQAKLQRAESLQEKSVKEAKTKCRTIASLLTAAPNPHSKGVLMFKK
RRQRAKKYTLVSFGAAAGTGTEEEEDGIPPTSESELDEEAFSDARSLTNQSDWDSPYLDM
ELARAGSGIAESQSSGLGGQLSEVSGRGVQLFEQQRQRVASSSQELAQVGPAAMLNGQSL
QSPPRAQSAPPEAAVLPLSPLSAPAASPSPFQDGGAPSPAPSIFNRSARPFTPGLPGQRS
GTTSVIFRPVAPKKVNEALGGTSPAPSPFAASLQGPTPLPSFTTVVPNRTPVSGTSSSTQ
RSSGPVTATSSLYIPAPSRPVTPGGAPEPPTPPSAAAMTSTASIFLSTPLRNSARPEAPG
TAAPEPASAREQRISVPAARTGILQEARRRGTRKQMFRPGKEETKNSPNPELLSLVQNLD
EKPRAGGAESGPEEDALSLGAEACNFMQPLGGRSYKTLSQVSPKTPPPMAPKTPPPMTPK
TPPPVAPKPGSRGLPDGLVNGSTSMVGIPELPRLQGRGGELFAKRQSRADRYVVEATPGS
SLNPGLRPRSPSPTPSLPPSWKYSPNIRAPPPIAYNPLLSPFFPQAARTLPNKAQSQGPR
ATPKQGIKALDFMRHQPYQLKTAMFCFDEGPSTPASTSGPPKTARVQEIRRFSTPAPQPT
AEPLAPTVLAPRAATTLDEPIWRAELASSPVPNPDHLESLRSFAATPTSCGFQVARPRFS
ATRTGLQAHVWRPGAGHH
Download sequence
Identical sequences D3ZZ68
ENSRNOP00000011956 ENSRNOP00000011956 NP_001292067.1.100692 NP_001292067.1.4139 10116.ENSRNOP00000011956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]