SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012690 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012690
Domain Number 1 Region: 108-200
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-18
Family PDZ domain 0.00014
Further Details:      
 
Domain Number 2 Region: 193-293
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-17
Family PDZ domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012690   Gene: ENSRNOG00000009528   Transcript: ENSRNOT00000012690
Sequence length 296
Comment pep:known chromosome:RGSC3.4:3:141891232:141919899:1 gene:ENSRNOG00000009528 transcript:ENSRNOT00000012690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLYPSLEDLKVGQVIQAQARASPMMPTVMPTLPASMASAPPLSELYPNLAELESYMGL
SLSSQEVQKNLSQIPDGDNMVITSPGPGQVTAPVSGNDLGVLRAEIKPGVREIHLCKDER
GKTGLRLQAVDKGLFVQLVQANTPASLVGLRFGDQILQIDGCDCAGWSTHKAQKALKKAS
AEKIVMVVRDRPFQRTVTMHKDSSGQVGFFIKKGKIVSVVKGSSAARNGLLTNHYVCEVN
GQNVIGLKDKKIIEILTTAGNVITLTIIPTVIYEHMIKKLSPLLLHHTMDHSIPDT
Download sequence
Identical sequences Q4KLN0
ENSRNOP00000012690 NP_001020863.1.100692 NP_001020863.1.4139 XP_017447262.1.100692 10116.ENSRNOP00000012690 ENSRNOP00000012690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]