SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012864 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012864
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily UBC-like 2.75e-39
Family RWD domain 0.000000342
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000012864
Domain Number - Region: 150-227
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0706
Family Duffy binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012864   Gene: ENSRNOG00000009599   Transcript: ENSRNOT00000012864
Sequence length 292
Comment pep:known chromosome:RGSC3.4:8:91827450:91830574:1 gene:ENSRNOG00000009599 transcript:ENSRNOT00000012864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASIKESLQLQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYLDGTREALPPNIEFVIT
LQIEEPKVTIDLQVTMPHSYPYVALQLFGRSPELDRQQQLLLNQGLSAYLGTFDPGELCV
CAAIQWLQDNSASYFLNRKLSDEPSVQPKPVKNTFLRMWIYSHHIYQQDLRKKILEVGKR
LDVTGFCMTGKPGIICVEGFKDHCEEFWHTIRYPNWKHISCKHAETVETEGDGEDLRLFH
SFEELLLEAHGDYGLRNDYHMNLGQFLEFLRKHKSEHVFQILFGIESKSSES
Download sequence
Identical sequences D3ZAT3
10116.ENSRNOP00000012864 ENSRNOP00000012864 NP_001102243.1.100692 NP_001102243.1.4139 XP_006243545.1.100692 XP_006243547.1.100692 XP_006243548.1.100692 ENSRNOP00000012864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]