SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012974 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012974
Domain Number 1 Region: 17-260
Classification Level Classification E-value
Superfamily Aquaporin-like 3.92e-72
Family Aquaporin-like 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012974   Gene: ENSRNOG00000009686   Transcript: ENSRNOT00000012975
Sequence length 269
Comment pep:known chromosome:RGSC3.4:5:58433731:58447853:-1 gene:ENSRNOG00000009686 transcript:ENSRNOT00000012975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSVLENIQSVLQKTWVREFLAEFLSTYVLMVFGLGSVAHMVLGERLGSYLGVNLGFGF
GVTMGIHVAGGISGAHMNAAVTFTNCALGRMAWKKFPIYVLGQFLGSFLAAATTYLIFYG
AINHYAGGELLVTGPKSTANIFATYLPEHMTLWRGFVDEVFVTGMLQLCIFAITDKLNSP
ALQGTEPLMIGILVCVLGVSLGMNTGYAINPSRDLPPRFFTFIAGWGKKVFSAGNNWWWV
PVVAPLLGAYLGGIVYLGLIHAGIPPQGS
Download sequence
Identical sequences P56403
NP_062030.2.100692 NP_062030.2.4139 XP_017448684.1.100692 ENSRNOP00000012974 10116.ENSRNOP00000012974 ENSRNOP00000012974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]