SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013232 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013232
Domain Number 1 Region: 41-140
Classification Level Classification E-value
Superfamily PDZ domain-like 1.16e-21
Family PDZ domain 0.016
Further Details:      
 
Domain Number 2 Region: 136-237
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-21
Family PDZ domain 0.04
Further Details:      
 
Domain Number 3 Region: 242-346
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-20
Family PDZ domain 0.0000164
Further Details:      
 
Domain Number 4 Region: 446-544
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-20
Family PDZ domain 0.0000127
Further Details:      
 
Domain Number 5 Region: 653-744
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-20
Family PDZ domain 0.0000332
Further Details:      
 
Domain Number 6 Region: 544-646
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family PDZ domain 0.000033
Further Details:      
 
Domain Number 7 Region: 929-1027
Classification Level Classification E-value
Superfamily PDZ domain-like 2.8e-18
Family PDZ domain 0.0000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013232   Gene: ENSRNOG00000009726   Transcript: ENSRNOT00000013232
Sequence length 1043
Comment pep:known chromosome:RGSC3.4:4:125962551:126001803:-1 gene:ENSRNOG00000009726 transcript:ENSRNOT00000013232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAVSLKWRLGVVRRRPKDDGPYSKGGKDTAGTDGALVCRRQSIPEEFRGITMVELIKRE
GSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDLLNVGDYIRSVNGIRLTRLRHDEIITL
LKNVGERVVLEVEYELPPPAPENNPRIISKTVDVSLYKEGNSFGFVLRGGAHEDLHKSRP
LVLTYVRPGGPADREGSLKVGDRLLSIDGIPLHGASHATAIATLQQCSHEALFQVEYDVA
TPDTVANASGPLVVEIAKTPGSALGISLTTGSHRNKPAITIDRIKPASVVDRSGALHAGD
HILAIDGTSTEHCSLVEATKLLASVTEKVRLEILPAPQSRRPLKPPEAVRIQRSEQLHHW
DPCVPSCHSPRPSHCRAPTWAPGGQDQSRSVSSTPFSSPTMNPAFPCANASTLPRGPMSP
RTTAGRRRQRRKEHRSSLSLASSTVGPGGQIVHTETTEVVLCGDPLSGFGLQLQGGIFAT
ETLSSPPLVRFIEPDSPAERCGLLQVGDRVLAINGIATEDGTMEEANQLLRDAALARKVV
LEIEFDVAESVIPSSGTFHVKLPKRRGVELGITISSASRKRGEPLIISDIKKGSVAHRTG
TLEPGDKLLAIDNIRLDHCPMEYAVQILRQCEDLVKLKIRKDEDNSDEQESSGAVSYTVE
LKRYGGPLGITISGTEEPFDPIIISGLTKRGLAERTGAIHVGDRILAINSVSLKGRPLSE
AIHLLQVAGETVTLKIKKQLDRPLLPRQSGSLSEASDVDEDPPEALKGGLLTTHFSPAVP
SVDSAVESWGSSATEGGFGGSGSYTPQVAVRSVTPQEWRSSRLKSSPPPLEPRRTSYTPG
PTDESFPEEEEGDWEPPMSPAPGPAREEGFWRVLGEALEDLESCGQSELLRELEASIMTG
TVQSVAVDGRPGSRPWRRSREVGTSPEDLQELLLPTPLEMHRVTLHKDPVRNDFGFSVSD
GLLEKGVYVHTVRIDGPAQHGGLQPFDRLLQVNHVRTRDFDCCLAVPLLAEAGDILELVV
SRNPLAQSRRTPGAPGPSSPQMI
Download sequence
Identical sequences Q9WTW1
NP_612544.2.100692 NP_612544.2.4139 ENSRNOP00000041016 10116.ENSRNOP00000041016 ENSRNOP00000013232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]