SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013481 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013481
Domain Number 1 Region: 380-546,842-1060,1114-1157
Classification Level Classification E-value
Superfamily Ras GEF 7.32e-108
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 527-614
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-19
Family PDZ domain 0.006
Further Details:      
 
Domain Number 3 Region: 258-382
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.71e-18
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 4 Region: 17-118
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000524
Family cAMP-binding domain 0.0057
Further Details:      
 
Domain Number 5 Region: 752-831
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000184
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013481   Gene: ENSRNOG00000009995   Transcript: ENSRNOT00000013481
Sequence length 1614
Comment pep:known chromosome:RGSC3.4:10:39935952:40101623:1 gene:ENSRNOG00000009995 transcript:ENSRNOT00000013481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPVDPGARQALRKKPPERTPEDLNIIYSYLHGMEILSNLREHQLRLMSTRARYERYNG
NQMLFCSETIARCWYILLSGSVLVKDSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVEN
SKDNEDSILQREIPARQSRRRFRKINYKGERQTIIDGVDVNNYLSLPADLTKMHLTDNPH
PQVTHVTSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDEEEEEEEI
DRTDPLQGRDLVRECLEKEPADKTDDDVEQLLEFMHQLPAFANMTMSVRRELCSVMIFEV
VEQAGAVILEDGQELDSWYVILNGTVEISHPDGKIENLFMGNSFGIVPTLDKQHMRGVVR
TKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIKAT
PERLIMHLIEEHSIVDPTYIEDFLLTYRTFLETPLDVGIKLLEWFKIDSLRDKVTRIVLL
WVNNHFNDFEGDPAMTRFLEEFEKNLEDTKMNGHLRLLNIACAAKAKWRQVVLQKASRES
PLHFSLTGGSEKGFGVFVEVVEPGTKAADAGLKRGDQIMEVNGQNFENITFAKALEILRN
NTHLALTVKTNIFVFKELLSRTEQEKSGVPHIPKIAEKKSNRHSIQDVPGDIEQVPQEKG
NKKIKANTVSGGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDSIVGTRHCRHSLAIMP
IPGTLSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKADQQSCYIIISKDTTAKEVVCQA
VQEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMETETLC
SDEDAQELLKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTGNTHL
KQFEDIVNQETFWVATEILSESNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLA
PVARLRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDM
TFLHEGNDSKVDGLVNFEKLRMIAKEIRHIIRMTSANMDPAMMFRQRKKRWRSLGSLSQG
STNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDIDTEEEKFQMMSL
QWEPAYGTLTKSLTEKKSARSSEMSPVPLRSAGHTAKVHLHQPHRVSQVLQVPAVNLHPI
RKKGQTRDHVLSTNLPQKGLGPTEEVSGKKHTEDTISVASSLHSSPPASPQSSPRKGCTL
TPSSKCDNLSDSSHSEISSRSSIVSNGSVDSMSAAGQDERCSAHSLAVPEPTGAWEKTDH
PSGISDHSQLAHGWMLSKPSLIKGVAVSSSLSSEEMSQEHVVLEAADSGRGSWTSCSSSS
HDNFQSLQNQKSWDFLNSYRHTHLGDPIAEVEPPDCEPCACPKGCSRTCSQCKGSLETNQ
LRQSWASSSSLSDTWEPNYGTVKRRVLESTPAEAPDGLEPRDTSDPVYKTVTSSTDKGLI
VYCVTSPKKGDRHREPPPTPPGYLGISLADLKEGSHPHLKPPDYSVAVQRSKMMLLNSLS
RLPPAPPSSHTSAWVPSKIGSQPQRHSLQPSHPKLADVADADSEADENEQVSAV
Download sequence
Identical sequences XP_006246339.1.100692 ENSRNOP00000013481 10116.ENSRNOP00000013245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]