SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013486 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013486
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily UBC-like 3.95e-57
Family UBC-related 0.000000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013486   Gene: ENSRNOG00000010041   Transcript: ENSRNOT00000013486
Sequence length 170
Comment pep:known chromosome:RGSC3.4:10:59495501:59576921:1 gene:ENSRNOG00000010041 transcript:ENSRNOT00000013486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLT
FPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI
MISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Download sequence
Identical sequences A0A096P2F5 A0A0D9RL78 A0A0P6J3F6 A0A1S2ZLD8 A0A1U7Q444 A0A1U7SDW5 A0A218V1L6 A0A250XVM7 A0A2D4FDI3 A0A2I2ZY55 A0A2K5NDL2 A0A2K5PRS9 A0A2K5TYD2 A0A2K6DTR2 A0A2K6JLZ6 A0A2K6N7W8 A2VE20 F1RGQ5 F6RWZ1 G1Q4K1 G3T9B3 H2NSB0 H9FZA3 K7CGF3 P62253 P62254 P62255 Q5F239 Q5ZLH8 U3JXI5 U6CT27 W5M3S2
ENSFALP00000007489 ENSMLUP00000018634 ENSDNOP00000021003 ENSP00000380178 ENSRNOP00000013486 ENSGGOP00000010778 10090.ENSMUSP00000021148 10116.ENSRNOP00000013486 9600.ENSPPYP00000008817 9606.ENSP00000380178 9913.ENSBTAP00000019194 9986.ENSOCUP00000000216 ENSRNOP00000013486 ENSCJAP00000021627 gi|13489085|ref|NP_003333.1| ENSBTAP00000019194 ENSOCUP00000000216 ENSP00000380178 ENSLAFP00000010361 ENSPPYP00000008817 ENSBTAP00000019194 ENSMUSP00000021148 ENSMUSP00000021148 ENSMUSP00000021148 ENSGGOP00000010778 ENSPPYP00000008817 NP_001074352.1.86415 NP_001075927.1.59421 NP_001075927.1.76553 NP_003333.1.87134 NP_003333.1.92137 NP_073181.1.100692 NP_073181.1.4139 NP_080261.2.92730 XP_002747891.1.60252 XP_003799095.1.62490 XP_004058360.1.27298 XP_004267069.1.21590 XP_004376179.1.4749 XP_004433313.1.5094 XP_004638354.1.9945 XP_004672459.1.11716 XP_004684814.1.23501 XP_004857296.1.39548 XP_005056494.1.66865 XP_005067494.1.91757 XP_005284437.1.60341 XP_005349678.1.66349 XP_005399749.1.28644 XP_005525926.1.90289 XP_006079738.1.26621 XP_006093834.1.53796 XP_006105338.1.53796 XP_006640893.1.81211 XP_006863341.1.41390 XP_006899820.1.29581 XP_006922275.1.64745 XP_006992267.1.50099 XP_007102855.1.24612 XP_007177479.1.59432 XP_007521164.1.11023 XP_007935685.1.48129 XP_008008102.1.81039 XP_008046079.1.4292 XP_008154974.1.99482 XP_008517571.1.77740 XP_008853857.1.79516 XP_010380488.1.97406 XP_010571800.1.12557 XP_010594819.1.64505 XP_010845760.1.44457 XP_010968253.1.22495 XP_011579846.1.59079 XP_011723429.1.29376 XP_011911047.1.92194 XP_012634644.1.48125 XP_014688130.1.49734 XP_014743488.1.99236 XP_014964304.1.54773 XP_014973756.1.72884 XP_015502333.1.82291 XP_015676548.1.16292 XP_015736090.1.68032 XP_015994292.1.101085 XP_016056440.1.3490 XP_016786741.1.37143 XP_017367669.1.71028 XP_017684353.1.3805 XP_017715678.1.44346 XP_017919929.1.57651 XP_019269366.1.44245 XP_019515419.1.44202 XP_019599398.1.88060 XP_019782416.1.83887 XP_019836546.1.53367 XP_020667804.1.8467 XP_020738518.1.74333 XP_020820300.1.61212 XP_020923359.1.46622 XP_021068123.1.100879 XP_021406562.1.53032 XP_021513089.1.76796 XP_021550548.1.83697 XP_021550550.1.83697 ENSLOCP00000003030 ENSLAFP00000010361 ENSMLUP00000018634 ENSPANP00000019530 ENSP00000380178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]