SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013563 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013563
Domain Number 1 Region: 105-198
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-21
Family PDZ domain 0.0000269
Further Details:      
 
Domain Number 2 Region: 197-295
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-16
Family PDZ domain 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013563   Gene: ENSRNOG00000009683   Transcript: ENSRNOT00000013563
Sequence length 300
Comment pep:known chromosome:RGSC3.4:5:19822458:19849209:1 gene:ENSRNOG00000009683 transcript:ENSRNOT00000013563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLYPSLEDLKVDKVIQAQTASSANPASQAFFLNVVDSAAFPPGGNLYPKLYPELSQYMG
LSLSEAEICENMPVVSGAPTQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILC
KDQDGKIGLRLKSVDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVL
KQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHI
CEINGQNVIGLKDAQIADILSTAGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
Download sequence
Identical sequences Q9JI92
ENSRNOP00000013563 10116.ENSRNOP00000013563 ENSRNOP00000013563 NP_114192.1.100692 NP_114192.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]