SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013803 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013803
Domain Number 1 Region: 21-267
Classification Level Classification E-value
Superfamily Aquaporin-like 4.71e-76
Family Aquaporin-like 0.00000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013803   Gene: ENSRNOG00000009797   Transcript: ENSRNOT00000013803
Sequence length 292
Comment pep:known chromosome:RGSC3.4:5:58501642:58507161:-1 gene:ENSRNOG00000009797 transcript:ENSRNOT00000013803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTIN
LAFGFAVTLAILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVF
GLYYDAIWAFAGNELVVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVD
PYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGQ
NWWWVPIVSPLLGSIGGVFVYQLMIGCHLEQPLPSTEAENVKLAHMKHKEQI
Download sequence
Identical sequences A0A0G2JSK0
ENSRNOP00000013803 10116.ENSRNOP00000013803 ENSRNOP00000013803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]