SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013904 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013904
Domain Number 1 Region: 58-116
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 5.89e-17
Family AN1-like Zinc finger 0.0000341
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000000301
Family AN1-like Zinc finger 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013904   Gene: ENSRNOG00000010342   Transcript: ENSRNOT00000013905
Sequence length 268
Comment pep:known chromosome:RGSC3.4:2:93397683:93406694:1 gene:ENSRNOG00000010342 transcript:ENSRNOT00000013905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELDIGQHCQVQHCRQRDFLPFVCDGCSGIFCLEHRSKDSHGCPEANVIKERLKTDEHK
SYPCSFKGCAEVELVAVICPYCEKNFCLRHRHQSDHECEKLEIPKPRMAATQKLVRDIVD
AKAGGAASKGRKGAKSSRTAAKVALMKLKMHADGDKSLPQTERTYFQVYLPKGSQEKSKA
MFFCLRWSIGKVVDVAASLAGLRNENNKLTAKKLRLCHVPSGEALPLDHTLERWITKEEC
PLYNGGNVILEYLNEEEQFVKDVDSYLE
Download sequence
Identical sequences D3ZQI4
10116.ENSRNOP00000013904 XP_001055634.2.4139 XP_342214.4.100692 ENSRNOP00000013904 ENSRNOP00000013904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]