SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014094 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014094
Domain Number 1 Region: 424-625
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.01e-56
Family Nucleotide and nucleoside kinases 0.00021
Further Details:      
 
Domain Number 2 Region: 218-340
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-29
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 128-231
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-19
Family PDZ domain 0.0022
Further Details:      
 
Domain Number 4 Region: 85-135
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000577
Family L27 domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014094   Gene: ENSRNOG00000010486   Transcript: ENSRNOT00000014094
Sequence length 635
Comment pep:known chromosome:RGSC3.4:9:57696943:57736126:-1 gene:ENSRNOG00000010486 transcript:ENSRNOT00000014094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQSDRGAELTDEDRALSTAPNPENGLSGILRLLLQELSLFYSRDVHGLCLLYDLLHSPW
LQALLKVYDCLQKFKEKKLVPATTHAQILSCEVLELLPKASSSPEIQELRQVLQAPHCKA
LLRAHDTVAQKDFEPLLPPLPDNIPDSEEAMRTVCLVKNQQPLGATIKRHEITGDILVAR
VIHGGLVERSGLLYAGDKLVEVNGVPVEGLDPEQVIHILAMSCGTIMFKVIPVSAPPVSS
QTTVYVRAMIDYWPQEDPDIPCMDAGLPFLKGDILQIVDQSDALWWQARKISDLAICAGL
IPSNHLLKRKQREFWWSQPYQPHTCLKSTRSLSVEEEDSMKIDEKCVEADEETFESEELA
EAKEEFVGDGQQFFIAGFRRSMRLCRRKSHFSQLHANMRCTCSCYSAVGAPYEEVVRYQR
QPADKHRLIVLVGPSGVGVNELRRQLIGCNPSCFQSAVPHTTRSPKSYEMDGREYHYVSR
ETFESLMYGHRMLEFGEYKGHLYGTSVNAVLAVLDEGKICVMDLEPQDIQLARTRELKPY
VIFIKPPSMSSMRHSRRNAKIITDYFVDMKFKDEDLQEMEELAQKMESQFGQFFDHVIVN
DNLQDARAQLLSAIQKAEEELQWVPEAWVSPGAES
Download sequence
Identical sequences F1MA44
10116.ENSRNOP00000032344 NP_067088.2.100692 NP_067088.2.4139 XP_006245073.1.100692 ENSRNOP00000014094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]