SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014116 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014116
Domain Number 1 Region: 209-267
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000223
Family PDZ domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014116   Gene: ENSRNOG00000010556   Transcript: ENSRNOT00000014116
Sequence length 942
Comment pep:known chromosome:RGSC3.4:2:127564813:127639260:1 gene:ENSRNOG00000010556 transcript:ENSRNOT00000014116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPARRDPRGRAPELPGDLSSQEEEEEESDSDAGASSLGSCSSASSDTDLEPEWLDSVQ
RNGELFYLELSEDEEESLLPETQTVNHVNHVRFSEKEVIIEEDDSRERKKYEPKLRRFTK
ILKSKSLLPKRHHKKKSSNTGPVSILKHQSTQRTGVTVQQRYKDVTVYINPKKLTAIKAR
EQAKLLEVLVGVIHQTKWSWKRSGKQADGERLVVHGLVPGGSAMKSGQVLVGDVLVAVND
VDVTSENIERVLSCIPGPMQVKLTFENAYAVKKETAQPKKKKAQSSTNDLVKLLCGSEAD
ATQHSTLSIPHITMYLTLQLQSEVAREEQEMLYHYPVSEASQKLKSVRGIFLTLCDMLES
VTGTQVTSSSLHVNGKQIHVAYLKESDKLLLIGLPAEEVPLPQLRNMTEDVAQTLKFMYG
SLDSAFCQVENTPRLDHFFSLFFERALRPGKLHLSASPSAQQYDAASAVLLDNLPGVRWL
LLPQELKVELDTALSDLEAADFQELSEDYYDMRRLYTILGSSLFYKGYMVCSHLPKDDVV
EIAAYCRQYCLLPLAAQQRIGQLIIWREVFPQHHLQPATDSDPEAFQEPEGRYFLLIVGL
RHYMLCVLLEAGGCASKATGNPGPDCIYVDQARATLHQLEGVESRIEEQLAATPGPCLSC
ADWFLAAPREKADSLTTSPILGRLQGPSKTAASPTCRRTFFSDYSFKARKPSPSRIGGGR
EPGEGEENVGLSPHTTPDTVRKQRESEGSDDNVALLKLARKKSTLPNPFHLGTSKKELSE
KELEVYNMMKLTSGPENTLFHYVALETVQGIFITPTHEEVAQLGGSVHSQLIKNFHRCCL
TIRAVFQQTLKVEKKKALSDGDHLESANSVSSLSPVKEHGVLFECSPENWTDQKKTPPVM
SYWVVGRLFLNPKPQELYVCFHDSVSEIAIEMAFRLFFGLTL
Download sequence
Identical sequences D4ACE5
ENSRNOP00000014116 10116.ENSRNOP00000014116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]