SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014142 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014142
Domain Number 1 Region: 7-475
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.7e-144
Family Pyridoxal-dependent decarboxylase 0.000000000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014142   Gene: ENSRNOG00000010262   Transcript: ENSRNOT00000014142
Sequence length 656
Comment pep:known chromosome:RGSC3.4:3:114119320:114138114:-1 gene:ENSRNOG00000010262 transcript:ENSRNOT00000014142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEPSEYREYQARGKEMVDYICQYLSTLRERQVTPNVKPGYLRAQIPSSAPEEPDSWDSI
FGDIEQIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEM
NIMDWLAKMLGLPDFFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKAHEPNAD
ESSLNARLVAYASDQAHSSVEKAGLISLVKIKFLPVDDNFSLRGEALQKAIEEDKQQGLV
PVFVCATLGTTGVCAFDKLSELGPICAREGLWLHVDAAYAGTAFLCPELRGFLKGIEYAD
SFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRF
RSIKLWFVIRSFGVKNLQAHVRHGTDMAKYFESLVRSDPVFEIPAERHLGLVVFRLKGPN
CLTESVLKEIAKTGQVFLIPATIQDKLIIRFTVTSQFTTKDDILRDWNLIREAANLVLSQ
HCTSQPSPRAKNLIPPPVTRDSKDLTNGLSLESVNEGGDDPVQVRKIFRLPGDSLETTMD
PFDDCFSEEASDTTKHKLSSFLFSYLSVQNKKKTMRSLSCNSMPMSAQKSPPPDASVKHG
GFFRARIFSGFPEEMMMMKKGGFKKLIKFYSVPSFPECSSQCGTLQLPCCPLQAMV
Download sequence
Identical sequences A1A5M4
NP_058712.2.100692 NP_058712.2.4139 ENSRNOP00000014142 10116.ENSRNOP00000014142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]