SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014546 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014546
Domain Number 1 Region: 54-469
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.61e-80
Family GABA-aminotransferase-like 0.0000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014546   Gene: ENSRNOG00000010882   Transcript: ENSRNOT00000014546
Sequence length 473
Comment pep:known chromosome:RGSC3.4:17:17576401:17615246:1 gene:ENSRNOG00000010882 transcript:ENSRNOT00000014546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVAEQWVLVEMVQALYEAPAYHLILEGILILWIIRLVFSKTYKLQERSDLTAKEKEEL
IEEWQPEPLVPPVSRNHPALNYNIVSGPPTHNIVVNGKECVNFASFNFLGLLANPRVKAA
AFASLKKYGVGTCGPRGFYGTFDVHLDLEERLAKFMKTEEAIIYSYGFSTIASAIPAYSK
RGDIVFVDSAACFAIQKGLQASRSDIKLFKHNDVADLERLLKEQEIEDQKNPRKARVTRR
FIVAEGLYMNTGTICPLPELVRLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGISIDDI
DLISANMENALASVGGFCCGRSFVVDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENP
GIFAVLKKKCQTIHKSLQGVSGLKVVGESLCPALHLQLEESTGSRERDMKLLQEIVEQCM
NKGIALTQARYLDKEEKCLPPPSIRVVVTVEQTDEELQRAAATIREAAQAVLL
Download sequence
Identical sequences D4A2H2
10116.ENSRNOP00000014546 ENSRNOP00000014546 NP_001101876.1.100692 NP_001101876.1.4139 ENSRNOP00000014546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]