SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014568 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014568
Domain Number 1 Region: 16-96
Classification Level Classification E-value
Superfamily CAD & PB1 domains 7.52e-38
Family PB1 domain 0.0000883
Further Details:      
 
Domain Number 2 Region: 133-251
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-23
Family PDZ domain 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014568   Gene: ENSRNOG00000010883   Transcript: ENSRNOT00000014568
Sequence length 372
Comment pep:known chromosome:RGSC3.4:3:159230673:159251755:1 gene:ENSRNOG00000010883 transcript:ENSRNOT00000014568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRGHRHGVSSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRVFIQKKEEADYSAFGTDTLIRKKNVLSNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQAGASLEPEDQDSDEDDIIIEG
SGEPQQIPKATPEALSLESLTQIELSFESGQNGFSPLQDTSLVAVPSSLDTESESRAPDQ
KLLEEDGTIITL
Download sequence
Identical sequences D4A2F2
10116.ENSRNOP00000014568 NP_001102079.1.100692 NP_001102079.1.4139 ENSRNOP00000014568 ENSRNOP00000014568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]