SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014749 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000014749
Domain Number - Region: 85-174
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0732
Family LacY-like proton/sugar symporter 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014749   Gene: ENSRNOG00000011009   Transcript: ENSRNOT00000014749
Sequence length 208
Comment pep:known chromosome:RGSC3.4:19:532349:572172:1 gene:ENSRNOG00000011009 transcript:ENSRNOT00000014749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVA
QVILALIAFICIETIMECSPCEGLYFFEFVSCSAFVVTGVLLILFSLNLHMRIPQINWSL
TDLVNTGLSTFFFFIASIVLAALNHKTGAEIAAVIFGFLATAAYAVSTFLAVQKWRVSIR
QQSANDYIRARTESRDVDGRPEIQRLDT
Download sequence
Identical sequences D4A110
ENSRNOP00000014749 10116.ENSRNOP00000014749 ENSRNOP00000014749 NP_001165622.1.100692 NP_001165622.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]