SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014828 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014828
Domain Number 1 Region: 284-409
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.09e-26
Family Regulator of G-protein signaling, RGS 0.0023
Further Details:      
 
Domain Number 2 Region: 498-631
Classification Level Classification E-value
Superfamily PX domain 5.36e-21
Family PX domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014828   Gene: ENSRNOG00000011116   Transcript: ENSRNOT00000014828
Sequence length 845
Comment pep:known chromosome:RGSC3.4:16:49444073:49518168:1 gene:ENSRNOG00000011116 transcript:ENSRNOT00000014828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFATLTQLCSFLVFDYSYRDYILSWYGNLSRDDGQLYHLLLDDFWDIAKQIRYRLSHVDV
VKVVCNDIVKALLTHFCDLKAATARHEEQPRPFVLHACLKDSHDEVRFLQTCSQVLVFCL
LPSKDIQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQMLLAQLEYREQMSGHHKRAYT
YAPSYEEFIKLINSNSDVEFLKQLRYQIVVEIIQATTISSFPQLKRHKGKESAAMKTDLL
RARNMKRYINQLTVAKKQCEKRIRILGGPAYDQQEDGVSDEGEGPQSQKILQFEDIMTNP
FYRERFGTYMERIDKRALVGFWESVEHLKNANKNEIPQLVSEMYQNFFVESKEIPVEKSL
YKEIQQCLVGNKGIEVFSKIQGDVYDVLRDRYYPSFLVSDLYEKLIHEEEEETPDSQLAS
GKDELGSGGEAGEEVVEGTSGVSDPASFAVIKLRELSEKLEYKRQALSSIQNAPKPDKKI
ISKLKDEILVIEKECTDLQLHMARTDWWCEHLGLWKASITSAEVTEENGEQMPCYFVRVN
LQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDHKFLEKSK
NQLNKFLQNLLSDERLFQSEALYAFLSPSPDYLKVIDVQGKKTSFSLSSFLEKLPRDFFS
HQEEEIEEDSDLSDYGDDVDGKKDALAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFG
RTINKQIRDTVNWIFSEQMVVYYISAFRDAFWPNGKLAPPTRIRSEAQSQETKQRAQQKL
LENIPDTLQSLVGQQNARHGIIKIFKALQETRANKHLLYVLMELLLTELCPELRAHLDQL
KAGQV
Download sequence
Identical sequences 10116.ENSRNOP00000014828 ENSRNOP00000014828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]