SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014988 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014988
Domain Number 1 Region: 410-518
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-25
Family PDZ domain 0.0033
Further Details:      
 
Domain Number 2 Region: 17-112
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-22
Family PDZ domain 0.0000904
Further Details:      
 
Domain Number 3 Region: 170-271
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-19
Family PDZ domain 0.025
Further Details:      
 
Domain Number 4 Region: 691-801
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000657
Family Nucleotide and nucleoside kinases 0.001
Further Details:      
 
Domain Number 5 Region: 519-595
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000656
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014988   Gene: ENSRNOG00000011077   Transcript: ENSRNOT00000014988
Sequence length 1745
Comment pep:known chromosome:RGSC3.4:1:119684774:119750781:-1 gene:ENSRNOG00000011077 transcript:ENSRNOT00000014988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVEWHLSKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSHPD
PDPVSDNEDDSYDEDVHDPRSGRGALANRRGEKSWARDRSASRDRSLSPRSDRRSVASSQ
PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS
VRSHDRPPRRSQSRSPDQRSEPSDHSTQSPQQPSNGSLRSREEERMSKPGAVSTPVKHVD
DHTPKAVEEVTVEKHEKQTPTLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRP
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIVPNKNRAEQLASVQYTLPKTAGGDRAD
FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
LAREEPDIYQIAKSEPRDAGTDHRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSP
QAQPQAIHRIDSPGLKTASQQKAEASSPVPYLSPETNPASSASAVKHNVNLTNVNLEEPT
PAPPTSHVSQADCLGAPSPEAPHTMLRDEGVSLPSHVDPAKVYRKEPYPEEMMRQNHILK
QPALGHPGQRLDKEPNPAYDPQLPYVEKQASRDLEQPPYRYESSSYTDQFSRNYDHRLRF
EDRVPTYEDQWSYYDDKQPYPTRPFDTQHPRDLDSRQHPEEASERGYFQRFEEPAPLPYD
SRPRYEQLPRTSTLRHEEQPTSGYEVHNRYRPEAQPYAPAGPKSSEPKQYFDQYPRSYEQ
VPPPGFTSKTGHYEPLHGAAVVPPLIPSSQHKPEVLPSATKPQPPPPALTEEEEDPAMKP
QSVLTRVKMFENKRSASLENKKDVNDTASFKPPEVASKPPSASLVGPKPVSQTQFSEHDK
TLYRLPEPQKPQAKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFESKPPAHIPAGHHS
EPAKPVHSQSQPNFSSYSSKGKPETDAMDRSFSEKRYDPTQAMPPPPPLPSQYSQPVPPL
SNSSLHIHSKAAQSEGNSVSLDFQNSYISKPDPPPSQSKPATFRPPTREDPPQTFYPQKS
FPDKASVNGAEQTQKTITPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETVHKPEL
SSKPPPSPKTLMKAHSSTQPPEFDSGVETFSVHTDKPKYQINNISTMPKAVPVSPSAVEE
DEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILP
PLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSV
LIDHF
Download sequence
Identical sequences ENSRNOP00000014988 10116.ENSRNOP00000014988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]