SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015006 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015006
Domain Number 1 Region: 20-102
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 3.53e-32
Family Cytochrome b5 0.0000111
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000015006
Domain Number - Region: 111-140
Classification Level Classification E-value
Superfamily Aquaporin-like 0.000107
Family Aquaporin-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015006   Gene: ENSRNOG00000011142   Transcript: ENSRNOT00000015006
Sequence length 146
Comment pep:known chromosome:RGSC3.4:19:37016959:37050718:1 gene:ENSRNOG00000011142 transcript:ENSRNOT00000015006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPEASGSGRNGQGSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEE
VLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPKDGDKDPSKNNSCQSSWA
YWIVPIVGAILIGFLYRHFWADSKSS
Download sequence
Identical sequences P04166
10116.ENSRNOP00000015006 ENSRNOP00000015006 NP_085075.1.100692 NP_085075.1.4139 ENSRNOP00000015006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]