SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015195 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000015195
Domain Number - Region: 87-121
Classification Level Classification E-value
Superfamily RAP domain-like 0.0314
Family RAP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015195   Gene: ENSRNOG00000011400   Transcript: ENSRNOT00000015195
Sequence length 133
Comment pep:known chromosome:RGSC3.4:2:89038373:89323703:-1 gene:ENSRNOG00000011400 transcript:ENSRNOT00000015195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEPKPYRPKPGSKRPLSALYRLESKEPFLSVGLFDYHGRVPPPPRAVIPLKRPRVAVT
TTRRGKGVFSMKGGSRSSVGGSSSSGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEK
QQKAEAVSTDKVI
Download sequence
Identical sequences Q569A4
NP_001020149.1.100692 NP_001020149.1.4139 ENSRNOP00000015195 10116.ENSRNOP00000015195 ENSRNOP00000015195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]