SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015276 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015276
Domain Number 1 Region: 629-903
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.97e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000773
Further Details:      
 
Domain Number 2 Region: 215-360
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-35
Family Third domain of FERM 0.00019
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-31
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 4 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-19
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-18
Family First domain of FERM 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015276   Gene: ENSRNOG00000011425   Transcript: ENSRNOT00000015276
Sequence length 913
Comment pep:known chromosome:RGSC3.4:5:75107225:75222620:-1 gene:ENSRNOG00000011425 transcript:ENSRNOT00000015276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRINNIRTSELPKEKTRSEVTCSIRFLDGLVQTFKVNKQDLGQSLLDMAYG
HLGVTEKEYFGLQHGDDPVDSPRWLEASKPLRKQLKGGLPCILHFRVRYFIPDPNTLQQE
QTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHIGDFNSSIHHPGYLADSQFIPDQ
NDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPVMRRSLSV
ERLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
SPKDSDSEVSQNHSPHRGSLSENNPAQSCLTQKSSSSVSPCSNAPGSFSPDGVDQQFLED
YHKVTKGGSIEEASQYYCDKNDDGDGYLVLIRITPDKEGRFGFNLKGGVDQKMPLVVSRI
NPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRKAVR
SLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLIQFEQLYRKKPGL
AVTFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGP
LPHTCAQFWQVVWDQKLSLVVMLTTLTERGRTKCHQYWPDPPDIMDHGIFHIQCQAEDCT
IAYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVKYVRSLRVGGEPALV
HCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQTLDPS
Download sequence
Identical sequences A0A096MJT2
10116.ENSRNOP00000056382 RnR47 ENSRNOP00000056382 ENSRNOP00000015276 XP_006225370.1.4139 XP_006238254.1.100692 XP_008761961.1.100692 XP_008774184.1.4139 XP_017449225.1.100692 XP_017458498.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]