SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015389 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015389
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family PDZ domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 635-699
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.25e-18
Family LIM domain 0.0092
Further Details:      
 
Domain Number 3 Region: 576-639
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.23e-17
Family LIM domain 0.0099
Further Details:      
 
Domain Number 4 Region: 543-574
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000143
Family LIM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 695-719
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000153
Family LIM domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015389   Gene: ENSRNOG00000011343   Transcript: ENSRNOT00000015389
Sequence length 726
Comment pep:known chromosome:RGSC3.4:16:10186330:10247798:-1 gene:ENSRNOG00000011343 transcript:ENSRNOT00000015389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTM
THLEAQNKIKSASYNLSLTLQKSKRPIPISTTAPPIQSPLPVIPHQKDPSLDTNSSLATP
SPSPEARASPGTSGTLEFGDTFSSSFSQTSVCTSHMEASGPVLPLGSPVAKASSEGTQGS
VSPKVLPGPSQPRLYNNPIGLYSAETLREMAQMYQMSLRGKASGAGLLGGSLPVKDLAVD
SASPVYQAVIKTQSKPEDEADEWARRSSNLQSRSFRILAQMTGTEYMQDPDEEALRRSST
PIEHAPVCTSQATSPLLPASAPSPAAASPIAASPTLATAAAAHAVAASAAGPASSPVENP
RPQASAYSPAAATSPAPAAHTSYSEGPAAPAPKPRVVTTASIRPSVYQPVPASPYSPSPG
ANYSPTPYTPSPAPAYTPSPAPTYTPSPAPTYSPSPAPAYTPSPAPNYNPTPSAAYSGGP
SESASRPPWVTDDSFSQKFAPGKSTTSVSKQTLPRGAPAYNPTGPQVTPLARGTFQRAER
FPASSRTPLCGHCNNVIRGPFLVAMGRSWHPEEFNCAYCKTSLADVCFVEEQNNVYCERC
YEQFFAPICAKCNTKIMGEVMHALRQTWHTTCFICAACKKPFGNSLFHMEDGEPYCEKDY
INLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKDKPLCKKH
AHAINV
Download sequence
Identical sequences A0A096MJ01
NP_001264094.1.100692 NP_001264094.1.4139 XP_006252699.2.100692 XP_017455698.1.100692 ENSRNOP00000015389 10116.ENSRNOP00000015302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]