SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015435 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015435
Domain Number 1 Region: 328-473
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.62e-22
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 
Domain Number 2 Region: 548-682
Classification Level Classification E-value
Superfamily PX domain 1.28e-21
Family PX domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015435   Gene: ENSRNOG00000011348   Transcript: ENSRNOT00000015435
Sequence length 880
Comment pep:known chromosome:RGSC3.4:8:93646372:93711257:-1 gene:ENSRNOG00000011348 transcript:ENSRNOT00000015435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSWVRTIGERLKQRLRLDVGREICRQYPLFCFLLLCLSAASLLLNRYLHVLMIFWSFVA
GVVTFYCSLGPDSLLPNIFFTIKYKPKQLGLQELFPQGHSCAVCGKVKCKRHRPSLLLEN
YQPWLDLKVSSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRITLRFFASVLVRR
IHKVDIPSIITKKLLKAAMKHIEVIVKARQKVKNTEYLQQAALEEYGPDLHVALRSRRDE
LQYLRKLTELLFPYILPPKATDCRSLTLLIREILSGSVFLPSLDFLADPDTVNHLLIIFI
DDSPPEKATEPASPLVPFLQKFAEPRNKKPSVLKLELKQIREQQDLLFRFMNFLKQEGAV
HVLQFCLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQ
RIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRNSK
FNRSTQKRGESFGISRIGSKIKGVFKSTTMEGAVLPSYGVAEGEDDFIEEGIVVLEDDSP
VEAVSTPNTPRNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPE
HWSVYRRYLEFYVLESKLTEFHGTFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLVQ
HPELSNSQLLADFLSPNGGETQFLDKILPDVNLGKIIKSVPGKLMKEKGQHLEPFIMSFI
NSCESPKPKPSRPELTILSPTSENNKKLFNDLFKNNANRAENTERKQNQNYFMEVMTVDG
VYDYLMYVGRVVFQVPDWLHHLLMGTRILFKNTLEMYTDYYLQCKLEQLFQEHRLVSLIT
LLRDAIFCENTEPRSLQDKQKGAKQTFEEMMNYIPGIIFK
Download sequence
Identical sequences ENSRNOP00000015435 10116.ENSRNOP00000053662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]