SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015454 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015454
Domain Number 1 Region: 624-754
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.8e-31
Family Synaptotagmin-like (S variant) 0.00000229
Further Details:      
 
Domain Number 2 Region: 1336-1455
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.37e-23
Family Synaptotagmin-like (S variant) 0.0088
Further Details:      
 
Domain Number 3 Region: 459-586
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-19
Family PDZ domain 0.0000175
Further Details:      
 
Domain Number 4 Region: 17-107
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.02e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015454   Gene: ENSRNOG00000011000   Transcript: ENSRNOT00000015453
Sequence length 1484
Comment pep:known chromosome:RGSC3.4:9:21089083:21385442:-1 gene:ENSRNOG00000011000 transcript:ENSRNOT00000015453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCAR
CGGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGAWFFGSGPQQPSQDGTLSDTATGAGS
EVPREKKARLQERSRSQTPLSTAAVSSQDTATPGAPLDRNKGAEPSQQALGPEQKQASRS
RSEPPRERKKAPGLSEQNGKGGQKSERKRVPKSVVQPGEGIADERERKERRETRRLEKGR
SQDYSDRPEKRDNGRVAEDQKQRKEEEYQTRYRSDPNLARYPVKAPPEEQQMRMHARVSR
ARHERRHSDVALPHTEAAAAAPAEATAGKRAPATARVSPPESPRARAPAAQPPTEHGPPP
PRPVPGPXKAKREKAESMLRNDSLSSDQSESVRPSPPKPHRPKRGGKRRQMSVSSSEEEG
VSTPEYTSCEDVELESESVSEKGDLDYYWLDPATWHSRETSPISSHPVTWQPSKEGDRLI
GRVILNKRTTMPKESGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVL
EWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQ
KMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPPRVDGRP
RNPYVKMYFLPDRSDKSKRRTKTVKKLLEPKWNQTFVYSHVHRRDFRERMLEITVWDQPR
VQDEESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKK
LQRSQRISDSDISDYEVDDGIGVVPPVGYRASARESKATTLTVPEQQRTTHHRSRSVSPH
RGDDQGRPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPADHRSRHVESQYSSEPD
SELLMLPRAKRGRSAESLHMTSELQPSLDRARSASTNCLRPDTSLHSPERERHSRKSERC
SIQKQSRKGTASDADRVLPPCLSRRGYATPRATDQPVVRGKHPTRSRSSEHSSVRTLCSM
HHLAPGGSAPPSPLLTYRTHRQGSPTQSPPADTSFGSRRGRQLPQVPVRSGSIEQASLVV
EERTRQMKMKVHRFKQTTGSGSSQELDHEQYSKYNIHKDQYRSCDNASAKSSDSDVSDVS
AISRASSTSRLSSTSFMSEQSERPRGRISSFTPKMQGRRMGTSGRAIIKSTSVSGEIYTL
ERNDGSQSDTAVGTVGAGGKKRRSSLSAKVVAIVSRRSRSTSQLSQTESGHKKLKSTIQR
STETGMAAEMRKMVRQPSRESTDGSINSYSSEGNLIFPGVRVGPDSQFSDFLDGLGPAQL
VGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACI
AKKKTRIARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDL
SSMVIGWYKLFPPSSLVDPTLAPLTRRASQSSLESSSGPPCIRS
Download sequence
Identical sequences ENSRNOP00000015454 10116.ENSRNOP00000014976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]