SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015534 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015534
Domain Number 1 Region: 896-944,1038-1132,1299-1559
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000000489
Family HspBP1 domain 0.046
Further Details:      
 
Domain Number 2 Region: 451-605,856-891,1080-1114
Classification Level Classification E-value
Superfamily ARM repeat 0.0000121
Family RPA1889-like 0.05
Further Details:      
 
Domain Number 3 Region: 961-1022
Classification Level Classification E-value
Superfamily GYF domain 0.0000732
Family GYF domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000015534
Domain Number - Region: 565-735
Classification Level Classification E-value
Superfamily Bacterial muramidases 0.00432
Family Bacterial muramidases 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015534   Gene: ENSRNOG00000011491   Transcript: ENSRNOT00000015534
Sequence length 1812
Comment pep:known chromosome:RGSC3.4:8:109211093:109304212:-1 gene:ENSRNOG00000011491 transcript:ENSRNOT00000015534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIIRENKDLACFYTTKHSWRGKYKRVFSVGTHAVTTYNPNTLEVTNQWPYGDICSISPV
GKGQGTEFNLTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFAEGKITGRRYNCYKHH
WSDTRRPVILEVTPGGFDQINPVTNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLH
LFASEQREEIIKSAVEHAGTYIGVSLRTRKEPLEFEQYLSLRFGKYSTDESITSLAEFVV
QKISPRHSEPVKRVLAVTETCLVERDPATYNIATLKPLGEVFALVCDSENPQVFTIEFIK
GQVRKYSSTERDSLLASLLDGVRASGNRDVCVKMTPTHKGQRWGLLSMPIDEEVESLHLR
FLAAPPNGNFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITALLAQEGDVVA
SNAELESQFQAVRRLVASKAGFLAFTQLPKFRERLGMKVVKALKRSNNGVIHAAVDMLCA
LMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNSHVDHGTGALVISSLLDFLTFALC
APYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAIVKGAGLVMKAIIEEGDREIATKM
QDLALSEGALPRHLHTAMFTISSDQRMLTNRQLSRHLVGLWTADNTTATNLLRRILPPGL
LAYLDSSDPVPEKDADRMHVRDNVKIAMDQYGKFNKVPEWQRLAGKAAKEVEKFAKEKVD
LVLMHWRDRMGIAQKENINQKPVVLRKRRQRIKIEANWDLFYYRFSQDHARSNLIWNFKT
REELKDTLESEMRTFNIDRELGSASVISWNHHEFEVKYECLAEEIKIGDYYLRLLLEEDE
NEESGSIKRSYEFFNELYHRFLLTPKVNMKCLCLQALAIVYGRCHEDIGPFTDTRYIIGM
LERCTDKLERDRLILFLNKLILNKKNVKDLMDSNGIRILVDLLTLAHLHVSRATVPLQSN
VIEASPDMKRESEKEWYFGNADKERSGPYGFHEMQELWAKGMLNAKTRCWAQGMDGWRPL
QAIPQLKWCLLASGQAVLNETDLATLILNMLITMCGYFPSRDQDNAIIRPLPRVKRLLSD
STCLPHLIQLLLTFDPILVEKVAILLHHIMQDNPQLPRLYLSGVFFFIMMYTGSNVLPVA
RFLKYTHTKQAFKSEESKGQDIFQRSILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPE
AIWSSEMRRLMIEKIAAHLADFTPRLQSNTRALYQYCPIPVINYPQLENELFCNIYYLKQ
LCDTLRFPDWPIKDPVKLLKDSLDAWKKEVEKKPPMMSIDDAYEVLNLPVGQGLHDESKI
RKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSTKIVDGPDPENIILILKTQSILF
NRHKEELQPYKYAGYPMLIRTITMETSDDLLFSKESPLLPAAAELAFHTVNCSALNAEEL
RRENGLEVLQEAFSRCVAVLSRSSKPSDMSVQVCGHISRCYSVAAQFEECREKITEMPGI
IKDLCRVLYFGKCIPRVAALAVDCVSSFAVDFWLQTHLFQAGILWYLLVYLFNYDYTLEE
SGIQKNEETNQQEVANSLAKLSVHALSRLGGYLPEDQATPENPTVRKSLAGMLTPYIARK
LAVVSATEILKMLNSNTENPYLMWNNSTRAELLEFLESQQENMIKKGDCDKTYGAEFVYS
EHAKELIVGEIFVRVYNEVPTFQLEVPKEFAASLLDYIGSQAQYLHTFMAITHAAKVESE
QHGDRLPRVEMALEALRNVIKYNPGSESECIGHFKLIFSLLRVHGAGQVQQLALEAVSLF
WRLCMLWHQIQR
Download sequence
Identical sequences ENSRNOP00000015534 10116.ENSRNOP00000015534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]