SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015687 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015687
Domain Number 1 Region: 184-538
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-83
Family Protein kinases, catalytic subunit 0.000000386
Further Details:      
 
Domain Number 2 Region: 32-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.12e-44
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015687   Gene: ENSRNOG00000011439   Transcript: ENSRNOT00000015687
Sequence length 590
Comment pep:known chromosome:RGSC3.4:1:267495491:267693137:1 gene:ENSRNOG00000011439 transcript:ENSRNOT00000015687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYYSLCDKQ
PIGRLLFRQFCETRPGLECYIQFLDLVAEYEITPDENLGAKGKEIMTKYLSPKSPVFIAQ
VGQDLVSQTEKKLLQSPCKELFSACAQSVHDYLKGDPFHEYLDSMYFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSPKFSEEAKSIC
NMLLTKDSKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIETECFKELNVFGPNGTLSPDLNRS
QPPEPPKKGLFHRLFRRQHQNNSKSSPTPKTSCNHRINSNHINSNSTGSS
Download sequence
Identical sequences Q66HL7
ENSRNOP00000015687 XP_006231748.1.100692 ENSRNOP00000015687 10116.ENSRNOP00000015687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]