SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015692 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015692
Domain Number 1 Region: 4-237
Classification Level Classification E-value
Superfamily Aquaporin-like 2.09e-70
Family Aquaporin-like 0.00000000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015692   Gene: ENSRNOG00000011648   Transcript: ENSRNOT00000015692
Sequence length 269
Comment pep:known chromosome:RGSC3.4:4:84098346:84110524:1 gene:ENSRNOG00000011648 transcript:ENSRNOT00000015692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSI
ATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVASAILSGITSSLL
ENSLGRNDLARGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGH
LLAIDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGSALAVLIYDFILAPRSSDFTD
RMKVWTSGQVEEYDLDADDINSRVEMKPK
Download sequence
Identical sequences P29975
ENSRNOP00000015692 NP_036910.1.100692 NP_036910.1.4139 ENSRNOP00000015692 10116.ENSRNOP00000015692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]